PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G134900.1
Common NamePOPTR_0005s14150g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 296aa    MW: 32778 Da    PI: 7.0278
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G134900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-4271061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qpkkfa vhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lqq+l+ql+
  Potri.005G134900.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPKKFASVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEERLRDPVYGCVGLISILQQRLKQLQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l ++k+e
  Potri.005G134900.1  98 NDLYSAKKE 106
                         ***999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6446107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPKKFASVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEERLRDPVY GCVGLISILQ QRLKQLQNDL YSAKKELVNY VEGQAMLPML  120
MQPQHLGNPS SSTVMQHNGM PMMGIPSVGQ MGMRADTHQH HHAHPQQIYE AQQLAAVVAA  180
REQEMLRAYE QQHQHHTQAQ RQHEIVRFNG GFDPANSVAA TGFNHVNPAA AMSPSLALGT  240
FDNTFQIQPQ GEPQPNQLQP ELLLQPQSQQ QQPQQLLQHP KSESEEGRST VGPSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.123330.0bud| catkin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307250.20.0LOB domain protein 28
SwissprotQ9FKZ31e-87LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9H6D50.0B9H6D5_POPTR; LOB domain protein 28
STRINGPOPTR_0005s14150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-85ASYMMETRIC LEAVES 2-like 1